PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010559131.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 91aa    MW: 10806.3 Da    PI: 9.2356
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010559131.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding33.87.7e-112868345
                     SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45
                     ++++eE++l+ +  k+ G + W++Ia +++ gRt++++  +w+
   XP_010559131.1 28 NMSEEEEDLICRMYKLVGDR-WALIAGRIP-GRTPEEVERYWL 68
                     689***************99.*********.***********7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM007171.6E-82573IPR001005SANT/Myb domain
CDDcd001674.60E-72869No hitNo description
PfamPF002497.2E-102869IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-112968IPR009057Homeodomain-like
PROSITE profilePS500906.763071IPR017877Myb-like domain
SuperFamilySSF466891.09E-83068IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0009913Biological Processepidermal cell differentiation
GO:0010063Biological Processpositive regulation of trichoblast fate specification
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 91 aa     Download sequence    Send to blast
MDKRRRRQSK AKASCSEEVS SIEWEAVNMS EEEEDLICRM YKLVGDRWAL IAGRIPGRTP  60
EEVERYWLMK YGAVFANRRR EHLLRNSTNN T
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010559134.17e-62PREDICTED: transcription factor CPC
RefseqXP_010559133.17e-62PREDICTED: transcription factor CPC
RefseqXP_010559131.17e-62PREDICTED: transcription factor CPC
RefseqXP_010559130.17e-62PREDICTED: transcription factor CPC
RefseqXP_010559129.17e-62PREDICTED: transcription factor CPC
SwissprotO220597e-51CPC_ARATH; Transcription factor CPC
TrEMBLA0A087H5K65e-50A0A087H5K6_ARAAL; Uncharacterized protein
STRINGAT2G46410.12e-48(Arabidopsis thaliana)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46410.16e-49MYB_related family protein