![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | XP_010559131.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 91aa MW: 10806.3 Da PI: 9.2356 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 33.8 | 7.7e-11 | 28 | 68 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 ++++eE++l+ + k+ G + W++Ia +++ gRt++++ +w+ XP_010559131.1 28 NMSEEEEDLICRMYKLVGDR-WALIAGRIP-GRTPEEVERYWL 68 689***************99.*********.***********7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00717 | 1.6E-8 | 25 | 73 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 4.60E-7 | 28 | 69 | No hit | No description |
Pfam | PF00249 | 7.2E-10 | 28 | 69 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-11 | 29 | 68 | IPR009057 | Homeodomain-like |
PROSITE profile | PS50090 | 6.76 | 30 | 71 | IPR017877 | Myb-like domain |
SuperFamily | SSF46689 | 1.09E-8 | 30 | 68 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0009913 | Biological Process | epidermal cell differentiation | ||||
GO:0010063 | Biological Process | positive regulation of trichoblast fate specification | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 91 aa Download sequence Send to blast |
MDKRRRRQSK AKASCSEEVS SIEWEAVNMS EEEEDLICRM YKLVGDRWAL IAGRIPGRTP 60 EEVERYWLMK YGAVFANRRR EHLLRNSTNN T |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_010559134.1 | 7e-62 | PREDICTED: transcription factor CPC | ||||
Refseq | XP_010559133.1 | 7e-62 | PREDICTED: transcription factor CPC | ||||
Refseq | XP_010559131.1 | 7e-62 | PREDICTED: transcription factor CPC | ||||
Refseq | XP_010559130.1 | 7e-62 | PREDICTED: transcription factor CPC | ||||
Refseq | XP_010559129.1 | 7e-62 | PREDICTED: transcription factor CPC | ||||
Swissprot | O22059 | 7e-51 | CPC_ARATH; Transcription factor CPC | ||||
TrEMBL | A0A087H5K6 | 5e-50 | A0A087H5K6_ARAAL; Uncharacterized protein | ||||
STRING | AT2G46410.1 | 2e-48 | (Arabidopsis thaliana) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G46410.1 | 6e-49 | MYB_related family protein |